PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F03522.1.p
Common NameEUGRSUZ_F03522, LOC104450286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 601aa    MW: 65440.9 Da    PI: 8.5754
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F03522.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.25.2e-31229286260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       dDgynWrKYGqK+vkgs fprsYY+Ct+++C+vkk  ers  d++++ei+Y+g+H+h+k
  Eucgr.F03522.1.p 229 DDGYNWRKYGQKHVKGSVFPRSYYKCTHPNCEVKKLFERSP-DGHITEIIYKGTHDHPK 286
                       8****************************************.***************85 PP

2WRKY106.81.1e-33402460159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Eucgr.F03522.1.p 402 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASNDPKAVITTYEGKHNHD 460
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.71223287IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-26224287IPR003657WRKY domain
SuperFamilySSF1182901.57E-24226287IPR003657WRKY domain
SMARTSM007744.9E-32228286IPR003657WRKY domain
PfamPF031062.1E-23229285IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-37387462IPR003657WRKY domain
SuperFamilySSF1182901.96E-29394462IPR003657WRKY domain
PROSITE profilePS5081138.664397462IPR003657WRKY domain
SMARTSM007743.4E-39402461IPR003657WRKY domain
PfamPF031062.0E-26403460IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MDAPSALGPH APRRSSDAAD DRGRTGCLRN SGPQDPGGRG ARYKLMSPAK LPISRSACVA  60
VPPGLSPTSF LESPVLLSNM KVVPSPTTGS FLERRMLHGS ISSTTGLTNN HPCRPDRFGE  120
KESGIFEFQP SPGPNPGTAE VNQKNKESMQ VHSHSQTQSL ALVPFVKSEL AVPSSELSLS  180
SPAKLVPSVA NPPDEVDSEE SNQQDHPGTG MQATQSDHKG NVMAERLSDD GYNWRKYGQK  240
HVKGSVFPRS YYKCTHPNCE VKKLFERSPD GHITEIIYKG THDHPKPLPN RRVAGGIILH  300
IQGDRSADVS PLTGETSSNV YCQTSNIIEP KSTTQLYLAA GNEDSVEGTA SLSYRIRDEV  360
DEDDPFSKRR RLDIGGLDVT PVIKPIREPR VVVQTLSEVD ILDDGYRWRK YGQKVVRGNP  420
NPRSYYKCTN AGCPVRKHVE RASNDPKAVI TTYEGKHNHD VPTARTSSHD MAAPIAPAGP  480
SRIGPEERET ISLDLGVGIS SAAEARFPNL QGSRHTIHQQ LVQNQIHSNN SSIKVLRATP  540
VSSYYRVENC GATTYCSTTE DLRGGRGLDV SPRNHSYSYQ QTVGRVITGP HACSPQNQSK  600
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-37227462877Probable WRKY transcription factor 4
2lex_A9e-37227462877Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1367371KRRRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F03522.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0195621e-53EU019562.1 Glycine max WRKY18 (WRKY18) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010063081.10.0PREDICTED: probable WRKY transcription factor 20 isoform X2
SwissprotQ93WV01e-171WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A059BVI20.0A0A059BVI2_EUCGR; Uncharacterized protein
STRINGVIT_19s0090g01720.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31332867
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-172WRKY family protein